Description
Cytokeratin 19 Antibody | RQ4521 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: 3D4
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This Cytokeratin 19 antibody is available for research use only.
Purity: Protein G affinity
Description: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
Immunogen: Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR were used as the immunogen for the Cytokeratin 19 antibody.
Storage: After reconstitution, the Cytokeratin 19 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
