CXCR4 Antibody | R32743

(No reviews yet) Write a Review
SKU:
800-R32743
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

CXCR4 Antibody | R32743 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This CXCR4 antibody is available for research use only.

Purity: Antigen affinity

Description: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Immunogen: Amino acids 265-294 (ILLEIIKQGCEFENTVHKWISITEALAFFH) from the human protein were used as the immunogen for the CXCR4 antibody.

Storage: After reconstitution, the CXCR4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose