CTR1 Antibody / Copper transporter 1 | RQ4345

CTR1 Antibody / Copper transporter 1 | RQ4345 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This CTR1 antibody is available for research use only.

Purity: Antigen affinity purified

Description: High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

Immunogen: Amino acids NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ were used as the immunogen for the CTR1 antibody.

Storage: After reconstitution, the CTR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.