CRY2 Antibody | R32258

(No reviews yet) Write a Review
SKU:
800-R32258
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

CRY2 Antibody | R32258 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: N/A

Limitation: This CRY2 antibody is available for research use only.

Purity: Antigen affinity

Description: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody.

Storage: After reconstitution, the CRY2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose