CRX Antibody (Cone-rod homeobox) | R32644

(No reviews yet) Write a Review
SKU:
800-R32644
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

CRX Antibody (Cone-rod homeobox) | R32644 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This CRX antibody is available for research use only.

Purity: Antigen affinity

Description: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Immunogen: Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.

Storage: After reconstitution, the CRX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose