Description
CRP Antibody / C-Reactive Protein | RQ4555 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse
Application: WB, IHC-P
Buffer: N/A
Limitation: This C Reactive Protein antibody is available for research use only.
Purity: Antigen affinity purified
Description: C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
Immunogen: Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA were used as the immunogen for the C Reactive Protein antibody.
Storage: After reconstitution, the C Reactive Protein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.