CHRNA3 Antibody | RQ4415

CHRNA3 Antibody | RQ4415 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This CHRNA3 antibody is available for research use only.

Purity: Antigen affinity purified

Description: After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]

Immunogen: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.

Storage: After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.