CEP68 Antibody | RQ4329

(No reviews yet) Write a Review
SKU:
800-RQ4329
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

CEP68 Antibody | RQ4329 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This CEP68 antibody is available for research use only.

Purity: Antigen affinity purified

Description: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

Immunogen: Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Storage: After reconstitution, the CEP68 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose