CD26 Antibody | R32041

(No reviews yet) Write a Review
SKU:
800-R32041
Weight:
1.00 KGS
€684.00
Frequently bought together:

Description

CD26 Antibody | R32041 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB

Buffer: N/A

Limitation: This CD26 antibody is available for research use only.

Purity: Antigen affinity

Description: Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.

Immunogen: Amino acids QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ of human CD26 were used as the immunogen for the CD26 antibody.

Storage: After reconstitution, the CD26 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

View AllClose