Description
CD229 Antibody / Ly9 | RQ4650 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: IHC-P, FACS
Buffer: N/A
Limitation: N/A
Purity: Antigen affinity purified
Description: T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.
Immunogen: Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.
Storage: After reconstitution, the CD229 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
