CD229 Antibody / Ly9 | RQ4650

CD229 Antibody / Ly9 | RQ4650 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: IHC-P, FACS

Buffer: N/A

Limitation: N/A

Purity: Antigen affinity purified

Description: T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.

Immunogen: Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.

Storage: After reconstitution, the CD229 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.