Description
ATP2A2 Antibody | R30156 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P
Buffer: N/A
Limitation: This ATP2A2 antibody is available for research use only.
Purity: Antigen affinity
Description: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
Immunogen: An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.
Storage: After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
