ATP11C Antibody | RQ6040

(No reviews yet) Write a Review
SKU:
800-RQ6040
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

ATP11C Antibody | RQ6040 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This ATP11C antibody is available for research use only.

Purity: Affinity purified

Description: ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.

Immunogen: Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody.

Storage: After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose