Description
ATF6 Antibody | R32695 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This ATF6 antibody is available for research use only.
Purity: Antigen affinity
Description: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).
Immunogen: Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.
Storage: After reconstitution, the ATF6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
