Description
ARHGEF1 Antibody | R32513 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This ARHGEF1 antibody is available for research use only.
Purity: Antigen affinity
Description: Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Immunogen: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.
Storage: After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
