ARC Antibody / Activity-regulated cytoskeleton-associated protein | R32271

ARC Antibody / Activity-regulated cytoskeleton-associated protein | R32271 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: N/A

Limitation: This ARC antibody is available for research use only.

Purity: Antigen affinity

Description: Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Immunogen: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.

Storage: After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.