Description
ARC Antibody / Activity-regulated cytoskeleton-associated protein | R32271 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB
Buffer: N/A
Limitation: This ARC antibody is available for research use only.
Purity: Antigen affinity
Description: Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
Immunogen: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Storage: After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
