APC2 Antibody | R32509

(No reviews yet) Write a Review
SKU:
800-R32509
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

APC2 Antibody | R32509 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Limitation: This APC2 antibody is available for research use only.

Purity: Antigen affinity

Description: APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Immunogen: Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.

Storage: After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose