ANGPTL3 Antibody | RQ4118

(No reviews yet) Write a Review
SKU:
800-RQ4118
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

ANGPTL3 Antibody | RQ4118 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This ANGPTL3 antibody is available for research use only.

Purity: Antigen affinity purified

Description: ANGPTL3 (Angiopoietin-Like 3), also known as ANGPT5, is a protein which in humans is encoded by the ANGPTL3 gene. The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. By radiation hybrid mapping and the use of surrounding genes, this gene is mapped to chromosome 1p31. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. Angptl3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), and increases plasma triglyceride and HDL cholesterol in rodents. ANGPTL3 inhibit endothelial lipase to catalyze HDL-phospholipid and increase HDL-PL levels.

Immunogen: Amino acids RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN from the human protein were used as the immunogen for the ANGPTL3 antibody.

Storage: After reconstitution, the ANGPTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose