Description
ALDH2 Antibody | RQ5544 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: 5G7
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, FACS, IF
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This ALDH2 antibody is available for research use only.
Purity: Affinity purified
Description: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Immunogen: Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.
Storage: After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
