AGO4 Antibody / Argonaute 4 | R32464

AGO4 Antibody / Argonaute 4 | R32464 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Limitation: This AGO4 antibody is available for research use only.

Purity: Antigen affinity

Description: AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

Immunogen: Amino acids KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD from the human protein were used as the immunogen for the AGO4 antibody.

Storage: Prior to reconstitution, store at 4oC. After reconstitution, the AGO4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.