Description
AGO2 Antibody / Argonaute 2 | R32463 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This AGO2 antibody is available for research use only.
Purity: Antigen affinity
Description: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen: Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.
Storage: Prior to reconstitution, store at 4oC. After reconstitution, the AGO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
