ADRA1A Antibody | R32076

ADRA1A Antibody | R32076 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, FACS, IHC-P

Buffer: N/A

Limitation: This ADRA1A antibody is available for research use only.

Purity: Antigen affinity

Description: ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.

Immunogen: Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.

Storage: After reconstitution, the ADRA1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.