ADAM28 Antibody | R32798

ADAM28 Antibody | R32798 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This ADAM28 antibody is available for research use only.

Purity: Antigen affinity

Description: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Storage: After reconstitution, the ADAM28 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.