Description
ACVR2B Antibody / ActRIIB | R32460 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Rat
Application: WB
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This ACVR2B antibody is available for research use only.
Purity: Antigen affinity
Description: Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
Immunogen: Amino acids VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE from the human protein were used as the immunogen for the ACVR2B antibody.
Storage: Prior to reconstitution, store at 4oC. After reconstitution, the ACVR2B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
