Description
ACTN3 Antibody | R32494 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This ACTN3 antibody is available for research use only.
Purity: Antigen affinity
Description: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.
Storage: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
