Description
ACTN3 Antibody / Alpha Actinin 3 | RQ4625 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: 9B5
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Mouse, Rat
Application: WB, IHC-P
Buffer: N/A
Limitation: N/A
Purity: Protein G affinity
Description: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Immunogen: Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.
Storage: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
