Description
ACTH Antibody | R31470 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: IHC-P
Buffer: N/A
Limitation: This ACTH antibody is available for research use only.
Purity: Antigen affinity
Description: Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
Immunogen: An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
Storage: After reconstitution, the ACTH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
