Description
ABR Antibody / Active BCR related | R32457 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This ABR antibody is available for research use only.
Purity: Antigen affinity
Description: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Immunogen: Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody.
Storage: Prior to reconstitution, store at 4oC. After reconstitution, the ABR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
