Description
12 Lipoxygenase Antibody | R32691 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Mouse, Rat
Application: WB
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This 12 Lipoxygenase antibody is available for research use only.
Purity: Antigen affinity
Description: ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
Immunogen: Amino acids 186-231 ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ were used as the immunogen for the 12 Lipoxygenase antibody.
Storage: After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.